Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BRCA1-associated protein (BRAP), partial

This Recombinant Human BRCA1-associated protein (BRAP), partial spans the amino acid sequence from region 2-262aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(BRAP2) (Impedes mitogenic signal propagation) (IMP) (RING finger protein 52) (RING-type E3 ubiquitin transferase BRAP2) (Renal carcinoma antigen NY-REN-63)

UniProt

Q7Z569

Expression Region

2-262aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKGGGGSGGGGSEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL11RA2 siRNA (Mouse)
CRM2034-01 15 nmol

IL11RA2 siRNA (Mouse)

Sign In for Pricing
View Details
IL11RA2 siRNA (Mouse)
CRM2034-02 30 nmol

IL11RA2 siRNA (Mouse)

Sign In for Pricing
View Details
KRT37/KRT38 Rabbit Polyclonal Antibody (BF488)
orb2496195 100 µL

KRT37/KRT38 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
ZP2 (IE-3) Alexa Fluor® 594
sc-32752 AF594 200 µg/mL

ZP2 (IE-3) Alexa Fluor® 594

Sign In for Pricing
View Details
Cluap1 Mouse shRNA Lentiviral Particle (Locus ID 76779)
TL505191V 500 µL Each

Cluap1 Mouse shRNA Lentiviral Particle (Locus ID 76779)

Sign In for Pricing
View Details
DMAC2 (NM_001167869) Human Tagged ORF Clone
RG229644 10 µg

DMAC2 (NM_001167869) Human Tagged ORF Clone

Sign In for Pricing
View Details