Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BRCA1-associated protein (BRAP), partial

This Recombinant Human BRCA1-associated protein (BRAP), partial spans the amino acid sequence from region 2-262aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(BRAP2) (Impedes mitogenic signal propagation) (IMP) (RING finger protein 52) (RING-type E3 ubiquitin transferase BRAP2) (Renal carcinoma antigen NY-REN-63)

UniProt

Q7Z569

Expression Region

2-262aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKGGGGSGGGGSEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ac-WVAD-AMC
HY-P10240 1 Each

Ac-WVAD-AMC

Sign In for Pricing
View Details
Vstm2b ORF Vector (Mouse) (pORF)
ORF061675 1.0 µg DNA

Vstm2b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
1190007F08Rik Protein Lysate (Mouse) with C-HA Tag
10074034 100 µg

1190007F08Rik Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
CLEC2A, ID (CLEC2A, KACL, C-type lectin domain family 2 member A, Keratinocyte-associated C-type lectin, Proliferation-induced lymphocyte-associated receptor) (MaxLight 650)
MBS6286643-01 0.1 mL

CLEC2A, ID (CLEC2A, KACL, C-type lectin domain family 2 member A, Keratinocyte-associated C-type lectin, Proliferation-induced lymphocyte-associated receptor) (MaxLight 650)

Sign In for Pricing
View Details
CLEC2A, ID (CLEC2A, KACL, C-type lectin domain family 2 member A, Keratinocyte-associated C-type lectin, Proliferation-induced lymphocyte-associated receptor) (MaxLight 650)
MBS6286643-02 5x 0.1 mL

CLEC2A, ID (CLEC2A, KACL, C-type lectin domain family 2 member A, Keratinocyte-associated C-type lectin, Proliferation-induced lymphocyte-associated receptor) (MaxLight 650)

Sign In for Pricing
View Details
Gpr141 3'UTR Luciferase Stable Cell Line
TU108982 1.0 mL

Gpr141 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details