Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cyclic AMP-responsive element-binding protein 5 (Creb5)

This Recombinant Mouse Cyclic AMP-responsive element-binding protein 5 (Creb5) spans the amino acid sequence from region 1-357aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CREB-5) (cAMP-responsive element-binding protein 5) (CRE-BPa)

UniProt

Q8K1L0

Expression Region

1-357aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMSTIGHMMEMMGSRQDQTPHHHLHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVGSSTLSQLTTHRTDLNPIL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C/VIF1 Antibody
orb786939 2 mg

C/VIF1 Antibody

Sign In for Pricing
View Details
FDFT1 (NM_004462) Human Over-expression Lysate
LS002222 100 µg

FDFT1 (NM_004462) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CEACAM21 shRNA Plasmid
abx963920-01 150 µg

Human CEACAM21 shRNA Plasmid

Sign In for Pricing
View Details
Human CEACAM21 shRNA Plasmid
abx963920-02 300 µg

Human CEACAM21 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit anti-Cyclin El  IHC Antibody, Affinity Purified
IHC-00341-T 2.5 µg

Rabbit anti-Cyclin El IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
L-739943
T32507-01 25 mg

L-739943

Sign In for Pricing
View Details