Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UBA-like domain-containing protein 2 (UBALD2)

This Recombinant Human UBA-like domain-containing protein 2 (UBALD2) spans the amino acid sequence from region 2-164aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8IYN6

Expression Region

2-164aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPATPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQPTWPPGAQQGGAQQKAMAAMDGQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymine
TRC-T412150-1G 1 g

Thymine

Sign In for Pricing
View Details
DDX54 (NM_001111322) Human Over-expression Lysate
LC426366 20 µg

DDX54 (NM_001111322) Human Over-expression Lysate

Sign In for Pricing
View Details
Bis(2-ethylhexyl) Fumarate
TRC-B592035-50ML 50 mL

Bis(2-ethylhexyl) Fumarate

Sign In for Pricing
View Details
Dehydroepiandrosterone-d6
TRC-D229588-5MG 5 mg

Dehydroepiandrosterone-d6

Sign In for Pricing
View Details
Mouse Chkb activation kit by CRISPRa
GA200714 1 Kit

Mouse Chkb activation kit by CRISPRa

Sign In for Pricing
View Details
Itopride Hydrochloride
TRC-I931500-10MG 10 mg

Itopride Hydrochloride

Sign In for Pricing
View Details