Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled bile acid receptor 1 (GPBAR1), partial

This Recombinant Human G-protein coupled bile acid receptor 1 (GPBAR1), partial spans the amino acid sequence from region 283-330aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(G-protein coupled receptor GPCR19) (hGPCR19) (Membrane-type receptor for bile acids) (M-BAR) (hBG37) (BG37)

UniProt

Q8TDU6

Expression Region

283-330aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Gastroenterology & Hepatology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFA4L2 Rabbit Polyclonal Antibody
TA378995 100 µL

NDUFA4L2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal RNF11 Antibody [CoraFluor 1]
NBP2-98852CL1 0.1 mL

Rabbit Polyclonal RNF11 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Human Neutrophil Defensin 1 (DEFA1) ELISA Kit
IHUDEFA1KT 1 Each

Human Neutrophil Defensin 1 (DEFA1) ELISA Kit

Sign In for Pricing
View Details
Human OR8K5 (NM_001004058) AAV Particle
RC216940A1V 250 µL

Human OR8K5 (NM_001004058) AAV Particle

Sign In for Pricing
View Details
Elfacos EHP
BUP19677 1 g

Elfacos EHP

Sign In for Pricing
View Details
Cetrimide Broth (USP Basis)
31199-01 100 g

Cetrimide Broth (USP Basis)

Sign In for Pricing
View Details