Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Relaxin receptor 2 (RXFP2), partial

This Recombinant Human Relaxin receptor 2 (RXFP2), partial spans the amino acid sequence from region 33-158aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(G-protein coupled receptor 106) (G-protein coupled receptor affecting testicular descent) (Leucine-rich repeat-containing G-protein coupled receptor 8) (Relaxin family peptide receptor 2)

UniProt

Q8WXD0

Expression Region

33-158aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FALTQGSMITPSCQKGYFPCGNLTKCLPRAFHCDGKDDCGNGADEENCGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKETELECVNGDLKSVPMISNNVTLLSLKKNKIHSLPDKVFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- ((2-chlorophenyl) amino) -5-phenylcyclohex-2-en-1-one
BCA48076 250 mg

3- ((2-chlorophenyl) amino) -5-phenylcyclohex-2-en-1-one

Sign In for Pricing
View Details
Tbl1x (NM_001106964) Rat Tagged ORF Clone Lentiviral Particle
RR208276L3V 200 µL

Tbl1x (NM_001106964) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
XRCC3 Lentiviral Activation Particles (h2)
sc-405570-LAC-2 200 µL

XRCC3 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Rabbit Carbonic anhydrase related protein 11 (CA11) ELISA Kit
GTR10333492 96 Well

Rabbit Carbonic anhydrase related protein 11 (CA11) ELISA Kit

Sign In for Pricing
View Details
Human Heme Oxygenase 2 siRNA
abx902490-01 15 nmol

Human Heme Oxygenase 2 siRNA

Sign In for Pricing
View Details
Human Heme Oxygenase 2 siRNA
abx902490-02 30 nmol

Human Heme Oxygenase 2 siRNA

Sign In for Pricing
View Details