Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium/iodide cotransporter (SLC5A5), partial

This Recombinant Human Sodium/iodide cotransporter (SLC5A5), partial spans the amino acid sequence from region 547-643aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Na (+) (-) (Natrium iodide transporter) (Sodium-iodide symporter) (Na (+) (-) (Solute carrier family 5 member 5)

UniProt

Q92911

Expression Region

547-643aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BPI Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
13420064 1.0 µg DNA

BPI Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PPP5C AAV Vector (Human) (CMV)
37498101 1 µg

PPP5C AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rabbit Anti Human LRPPRC Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC,Immunofluorescence) 200UL
IRBAMLLRPPRCAP33200UL 200 µL

Rabbit Anti Human LRPPRC Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC,Immunofluorescence) 200UL

Sign In for Pricing
View Details
NRAS Recombinant Protein (Mouse)
RP154967 100 µg

NRAS Recombinant Protein (Mouse)

Sign In for Pricing
View Details
PNMA5, CT (PNMA5, KIAA1934, Paraneoplastic antigen-like protein 5, Tumor antigen BJ-HCC-25) (APC)
MBS6335324-01 0.2 mL

PNMA5, CT (PNMA5, KIAA1934, Paraneoplastic antigen-like protein 5, Tumor antigen BJ-HCC-25) (APC)

Sign In for Pricing
View Details
PNMA5, CT (PNMA5, KIAA1934, Paraneoplastic antigen-like protein 5, Tumor antigen BJ-HCC-25) (APC)
MBS6335324-02 5x 0.2 mL

PNMA5, CT (PNMA5, KIAA1934, Paraneoplastic antigen-like protein 5, Tumor antigen BJ-HCC-25) (APC)

Sign In for Pricing
View Details