Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium/iodide cotransporter (SLC5A5), partial

This Recombinant Human Sodium/iodide cotransporter (SLC5A5), partial spans the amino acid sequence from region 547-643aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Na (+) (-) (Natrium iodide transporter) (Sodium-iodide symporter) (Na (+) (-) (Solute carrier family 5 member 5)

UniProt

Q92911

Expression Region

547-643aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Rexo2 Pre-designed siRNA Set B
SI211817B 1 Each

Rat Rexo2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
C22orf13 Rabbit Polyclonal Antibody (FITC)
orb2087685 100 µL

C22orf13 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Bhlhe22 siRNA Oligos set (Mouse)
13312174 3x 5 nmol

Bhlhe22 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Recombinant Mycobacterium Bovis prrA Protein (aa 1-233)
VAng-Yyj3525-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Bovis prrA Protein (aa 1-233)

Sign In for Pricing
View Details
Recombinant Burkholderia cepacia Exodeoxyribonuclease 7 small subunit (xseB)
MBS1003171-01 0.02 mg (E-Coli)

Recombinant Burkholderia cepacia Exodeoxyribonuclease 7 small subunit (xseB)

Sign In for Pricing
View Details
Recombinant Burkholderia cepacia Exodeoxyribonuclease 7 small subunit (xseB)
MBS1003171-02 0.1 mg (E-Coli)

Recombinant Burkholderia cepacia Exodeoxyribonuclease 7 small subunit (xseB)

Sign In for Pricing
View Details