Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Indian hedgehog protein (IHH)

This Recombinant Chicken Indian hedgehog protein (IHH) spans the amino acid sequence from region 24-408aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IHH)

UniProt

Q98938

Expression Region

24-408aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CGPGRVVGSRRRPPRKLIPLAYKQFSPNVPEKTLGASGRYEGKIARNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGMLARLAVEAGFDWVYYESKAHIHCSVKSEHSAAAKTGGCFPGRALATLENGARTPLWALRPGQRVLAMDGAGRPTYSDFLAFLDKEPRALTAFHVIETRQPPRRLALTPTHLLFVADNASAPAAQFRPTFASHVQPGHFVLVAVGSGGLQPAEVVGVRGRTDVGAYAPLTRHGTLVVDDVVASCFALVREQQLAQMAFWPLRLYHSLLGGPGVQGDGVHWYSGLLYRLGRMLLPPDSFHPLGAPRAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV2-U6-Ndufs4-shRNA2-EGFP-Puro Plasmid
PVT67139 2 µg

PLV2-U6-Ndufs4-shRNA2-EGFP-Puro Plasmid

Sign In for Pricing
View Details
AF647 Mouse IgG2a, κ Isotype Control
JOT22439F 20Tests

AF647 Mouse IgG2a, κ Isotype Control

Sign In for Pricing
View Details
Mouse Monoclonal Ub-K63 Antibody (HWA4C4)
NBP2-00199-100ug 100 µg

Mouse Monoclonal Ub-K63 Antibody (HWA4C4)

Sign In for Pricing
View Details
Glutamic-Oxaloacetic Transaminase 1 Human Recombinant (GOT1 Human)
PT_40730-01 5 µg

Glutamic-Oxaloacetic Transaminase 1 Human Recombinant (GOT1 Human)

Sign In for Pricing
View Details
Glutamic-Oxaloacetic Transaminase 1 Human Recombinant (GOT1 Human)
PT_40730-02 25 µg

Glutamic-Oxaloacetic Transaminase 1 Human Recombinant (GOT1 Human)

Sign In for Pricing
View Details
Glutamic-Oxaloacetic Transaminase 1 Human Recombinant (GOT1 Human)
PT_40730-03 1 mg

Glutamic-Oxaloacetic Transaminase 1 Human Recombinant (GOT1 Human)

Sign In for Pricing
View Details