Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Methyltransferase-like protein 25 (METTL25)

This Recombinant Human Methyltransferase-like protein 25 (METTL25) spans the amino acid sequence from region 1-603aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8N6Q8

Expression Region

1-603aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

75.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAASCPLPVTPDLPTLRAKLQGLLQFLRDALSISNAHTVDFYTESVWEELVDLPPETVLAALRKSASETEALPSETRPLVEAEWEAGMTDFPKIFCETSQKLVSVEAFALAAKYYSVQNLGICTPFEQLLVALRGNQNQRIGENQKAVEFMNMKKSHEVQAMSELISSIADYYGIKQVIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNRKLKKHWKLCHAQSRLDVNGLALKMAKERKVQNKVKNKADTEEVFNNSPTNQEKMPTSAILPDFSGSVISNIRNQMETLHSQPHQEENLCFENSFSLINLLPINAVEPTSSQQIPNRETSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFTSNSEIKGVCSVGCCYHLLSEEFENQHKERTQEKWGFPMCHYLKEERWCCGRNARMSACLALERVAAGQGLPTESLFYRAVLQDIIKDCYGITKCDRHVGKIYSKCSSFLDYVRRSLKKLGLDESKLPEKIIMNYYEKYKPRMNELEAFNMLKVVLAPCIETLILLDRLCYLKEQEDIAWSALVKLFDPVKSPRCYAVIALKKQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBB6 Rabbit Polyclonal Antibody
TA362287 100 µL

TUBB6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Galectin-3BP/MAC-2BP/LGALS3BP Antibody [DyLight 594]
NBP2-97200DL594 0.1 mL

Rabbit Polyclonal Galectin-3BP/MAC-2BP/LGALS3BP Antibody [DyLight 594]

Sign In for Pricing
View Details
Porcine MCSF (Macrophage Colony Stimulating Factor 1) ValidElisa Kit
EK344029 96 Well

Porcine MCSF (Macrophage Colony Stimulating Factor 1) ValidElisa Kit

Sign In for Pricing
View Details
SERPINI2 Protein Vector (Mouse) (pPM-C-His)
PV228273 500 ng

SERPINI2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
DMGDH ORF Vector (Human) (pORF)
18312011 1.0 µg DNA

DMGDH ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Tmem216 (NM_026798) Mouse Tagged Lenti ORF Clone
MR200195L4 10 µg

Tmem216 (NM_026798) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details