Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 7D4 (OR7D4), partial

This Recombinant Human Olfactory receptor 7D4 (OR7D4), partial spans the amino acid sequence from region 161-197aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(OR19-B) (Odorant receptor family subfamily D member 4RT) (Olfactory receptor OR19-7)

UniProt

Q8NG98

Expression Region

161-197aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLMKRLTFSTGTEIPHFFCEPAQVLKVACSNTLLNNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vascular Endothelial Growth Factor C, Propeptide (VEGF-C, VEGF-A, Vascular permeability factor, VPF) (HRP)
MBS6505699-01 0.1 mL

Vascular Endothelial Growth Factor C, Propeptide (VEGF-C, VEGF-A, Vascular permeability factor, VPF) (HRP)

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor C, Propeptide (VEGF-C, VEGF-A, Vascular permeability factor, VPF) (HRP)
MBS6505699-02 5x 0.1 mL

Vascular Endothelial Growth Factor C, Propeptide (VEGF-C, VEGF-A, Vascular permeability factor, VPF) (HRP)

Sign In for Pricing
View Details
APC Anti-human CD165 Antibody *SN2*
116501B0-AAT 25 Tests

APC Anti-human CD165 Antibody *SN2*

Sign In for Pricing
View Details
Phospho-GATA3 (Ser308) Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-13294R-PE-Cy5.5 100 µL

Phospho-GATA3 (Ser308) Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
HMGB1 Antibody, HRP conjugated
A29997-50UG 50 µg

HMGB1 Antibody, HRP conjugated

Sign In for Pricing
View Details
PLV3-U6-LCK-shRNA1-CopGFP-Puro Plasmid
PVT83878 2 µg

PLV3-U6-LCK-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details