Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Estradiol 17-beta-dehydrogenase 11 (HSD17B11)

This Recombinant Human Estradiol 17-beta-dehydrogenase 11 (HSD17B11) spans the amino acid sequence from region 20-300aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(17-beta-hydroxysteroid dehydrogenase 11) (17-beta-HSD 11) (17bHSD11) (17betaHSD11) (17-beta-hydroxysteroid dehydrogenase XI) (17-beta-HSD XI) (17betaHSDXI) (Cutaneous T-cell lymphoma-associated antigen HD-CL-03) (CTCL-associated antigen HD-CL-03) (Dehydrogenase/reductase SDR family member 8) (Retinal short-chain dehydrogenase/reductase 2) (retSDR2) (Short chain dehydrogenase/reductase family 16C member 2)

UniProt

Q8NBQ5

Expression Region

20-300aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3-Dihydro-5-benzofuranethanol-d4
MBS6066748-01 2.5 mg

2,3-Dihydro-5-benzofuranethanol-d4

Sign In for Pricing
View Details
2,3-Dihydro-5-benzofuranethanol-d4
MBS6066748-02 5x 2.5 mg

2,3-Dihydro-5-benzofuranethanol-d4

Sign In for Pricing
View Details
BH3 Interacting Domain Death Agonist (Bid) Magnetic Fluorescence Assay Kit
MBS2155962-01 96 Tests

BH3 Interacting Domain Death Agonist (Bid) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
BH3 Interacting Domain Death Agonist (Bid) Magnetic Fluorescence Assay Kit
MBS2155962-02 5x 96 Tests

BH3 Interacting Domain Death Agonist (Bid) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
BH3 Interacting Domain Death Agonist (Bid) Magnetic Fluorescence Assay Kit
MBS2155962-03 10x 96 Tests

BH3 Interacting Domain Death Agonist (Bid) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
MTFR1 antibody
70R-18659 50 μL

MTFR1 antibody

Sign In for Pricing
View Details