Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Urocortin-3 (UCN3)

This Recombinant Human Urocortin-3 (UCN3) spans the amino acid sequence from region 119-161aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Stresscopin) (Urocortin III) (Ucn III)

UniProt

Q969E3

Expression Region

119-161aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slamf6 Mouse Gene Knockout Kit (CRISPR)
KN515847 1 Kit

Slamf6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Puerarin
TRC-P840130-5MG 5 mg

Puerarin

Sign In for Pricing
View Details
ZCCHC9 (NM_032280) Human Recombinant Protein
TP307448L 1 mg

ZCCHC9 (NM_032280) Human Recombinant Protein

Sign In for Pricing
View Details
Ammecr1 Mouse Gene Knockout Kit (CRISPR)
KN501197 1 Kit

Ammecr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DAPP1 Mouse Monoclonal Antibody [Clone ID: OTI7D4]
CF810236 100 µg

DAPP1 Mouse Monoclonal Antibody [Clone ID: OTI7D4]

Sign In for Pricing
View Details
Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody
TA364192 50 µL

Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details