Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Urocortin-3 (UCN3)

This Recombinant Human Urocortin-3 (UCN3) spans the amino acid sequence from region 119-161aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Stresscopin) (Urocortin III) (Ucn III)

UniProt

Q969E3

Expression Region

119-161aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 19 (BA17), Biotin conjugate, 0.1mg/mL
BNCB0666-500 1x 500 µL

Cytokeratin 19 (BA17), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
cis-4-Hydroxy-L-proline-d3 (Major)
TRC-H952379-50MG 50 mg

cis-4-Hydroxy-L-proline-d3 (Major)

Sign In for Pricing
View Details
Recombinant Human TLR4/CD284 Protein (His Tag)
PKSH031834 100 µg

Recombinant Human TLR4/CD284 Protein (His Tag)

Sign In for Pricing
View Details
3,4-Xylenol Phosphate
TRC-X749555-5G 5 g

3,4-Xylenol Phosphate

Sign In for Pricing
View Details
Aldehyde Oxidase (AOX1) Rabbit Polyclonal Antibody
AP17115PU-N 400 µL

Aldehyde Oxidase (AOX1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CFAP92 Human Gene Knockout Kit (CRISPR)
KN419149 1 Kit

CFAP92 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details