Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Urocortin-3 (UCN3)

This Recombinant Human Urocortin-3 (UCN3) spans the amino acid sequence from region 119-161aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Stresscopin) (Urocortin III) (Ucn III)

UniProt

Q969E3

Expression Region

119-161aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spermidine or Spermine N1-Acetyltransferase 1 (CPTC-SAT1-3), CF594 conjugate, 0.1mg/mL
BNC942273-500 1x 500 µL

Spermidine or Spermine N1-Acetyltransferase 1 (CPTC-SAT1-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Protein A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW06F-PA 10x 96 Well Plates

Protein A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS637639 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
GLP1 (GCG) (N-term) Rabbit Polyclonal Antibody
AP17420PU-N 400 µL

GLP1 (GCG) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MOT13 Antibody
8C16688-AAT 50 µg

MOT13 Antibody

Sign In for Pricing
View Details
EREG Rabbit Polyclonal Antibody
TA375972 100 µL

EREG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details