Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Piezo-type mechanosensitive ion channel component 1 (PIEZO1), partial

This Recombinant Human Piezo-type mechanosensitive ion channel component 1 (PIEZO1), partial spans the amino acid sequence from region 2198-2431aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Membrane protein induced by beta-amyloid treatment) (Mib) (Protein FAM38A)

UniProt

Q92508

Expression Region

2198-2431aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKVSPPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREPT Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-9971R-BF488 100 µL

CREPT Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Chol-CTPP
HY-144825 1 Each

Chol-CTPP

Sign In for Pricing
View Details
Pacrg sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3547905 3x 1.0 µg

Pacrg sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
SGC2085 (Standard)
HY-100565R 1 Each

SGC2085 (Standard)

Sign In for Pricing
View Details
MTG1 (NM_138384) Human Tagged Lenti ORF Clone
RC206871L4 10 µg

MTG1 (NM_138384) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olfr370 Mouse shRNA Plasmid (Locus ID 258267)
TR512853 1 Kit

Olfr370 Mouse shRNA Plasmid (Locus ID 258267)

Sign In for Pricing
View Details