Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Piezo-type mechanosensitive ion channel component 1 (PIEZO1), partial

This Recombinant Human Piezo-type mechanosensitive ion channel component 1 (PIEZO1), partial spans the amino acid sequence from region 2198-2431aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Membrane protein induced by beta-amyloid treatment) (Mib) (Protein FAM38A)

UniProt

Q92508

Expression Region

2198-2431aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKVSPPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Dystrobrevin alpha, DTNA ELISA Kit
MBS9330033-01 48 Well

Human Dystrobrevin alpha, DTNA ELISA Kit

Sign In for Pricing
View Details
Human Dystrobrevin alpha, DTNA ELISA Kit
MBS9330033-02 96 Well

Human Dystrobrevin alpha, DTNA ELISA Kit

Sign In for Pricing
View Details
Human Dystrobrevin alpha, DTNA ELISA Kit
MBS9330033-03 5x 96 Well

Human Dystrobrevin alpha, DTNA ELISA Kit

Sign In for Pricing
View Details
Human Dystrobrevin alpha, DTNA ELISA Kit
MBS9330033-04 10x 96 Well

Human Dystrobrevin alpha, DTNA ELISA Kit

Sign In for Pricing
View Details
KCNH3 (NM_012284) Human Tagged ORF Clone
RG214540 10 µg

KCNH3 (NM_012284) Human Tagged ORF Clone

Sign In for Pricing
View Details
N-Fmoc-8-aminooctanoic acid
459056-01 100 mg

N-Fmoc-8-aminooctanoic acid

Sign In for Pricing
View Details