Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Naja atra Cytotoxin 3b

This Recombinant Naja atra Cytotoxin 3b spans the amino acid sequence from region 22-81aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cardiotoxin 3b)

UniProt

Q98960

Expression Region

22-81aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Naja atra (Chinese cobra)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Btbd11 Mouse Gene Knockout Kit (CRISPR)
KN502294 1 Kit

Btbd11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CAPSL (NM_001042625) Human Recombinant Protein
TP305410M 100 µg

CAPSL (NM_001042625) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Apolipoprotein A1 (APOA1) ELISA Kit
RD-APOA1-Mu-01 96 Tests

Mouse Apolipoprotein A1 (APOA1) ELISA Kit

Sign In for Pricing
View Details
Mouse Apolipoprotein A1 (APOA1) ELISA Kit
RD-APOA1-Mu-02 48 Tests

Mouse Apolipoprotein A1 (APOA1) ELISA Kit

Sign In for Pricing
View Details
Heneicosane
TRC-H245500-5G 5 g

Heneicosane

Sign In for Pricing
View Details
CD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10F4]
TA802427BM 100 µL

CD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10F4]

Sign In for Pricing
View Details