Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP-dependent DNA/RNA helicase DHX36 (DHX36), partial

This Recombinant Human ATP-dependent DNA/RNA helicase DHX36 (DHX36), partial spans the amino acid sequence from region 89-179aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DEAD/H box polypeptide 36) (DEAH-box protein 36) (G4-resolvase-1) (G4R1) (MLE-like protein 1) (RNA helicase associated with AU-rich element protein)

UniProt

Q9H2U1

Expression Region

89-179aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey CENPE (Centromere Protein E) ELISA Kit
MBS2511118-01 24 Tests

Monkey CENPE (Centromere Protein E) ELISA Kit

Sign In for Pricing
View Details
Monkey CENPE (Centromere Protein E) ELISA Kit
MBS2511118-02 48 Tests

Monkey CENPE (Centromere Protein E) ELISA Kit

Sign In for Pricing
View Details
Monkey CENPE (Centromere Protein E) ELISA Kit
MBS2511118-03 96 Tests

Monkey CENPE (Centromere Protein E) ELISA Kit

Sign In for Pricing
View Details
Monkey CENPE (Centromere Protein E) ELISA Kit
MBS2511118-04 5x 96 Tests

Monkey CENPE (Centromere Protein E) ELISA Kit

Sign In for Pricing
View Details
Monkey CENPE (Centromere Protein E) ELISA Kit
MBS2511118-05 10x 96 Tests

Monkey CENPE (Centromere Protein E) ELISA Kit

Sign In for Pricing
View Details
Tityustoxin Kα
MDP0682 100 µg

Tityustoxin Kα

Sign In for Pricing
View Details