Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Taste receptor type 2 member 10 (TAS2R10), partial

This Recombinant Human Taste receptor type 2 member 10 (TAS2R10), partial spans the amino acid sequence from region 64-100aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(T2R10) (Taste receptor family B member 2) (TRB2)

UniProt

Q9NYW0

Expression Region

64-100aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzopyrene-13C4
TRC-B205802-25MG 25 mg

Benzopyrene-13C4

Sign In for Pricing
View Details
Berberine chloride
SM4144-10mM 10 mM x 0.2 mL

Berberine chloride

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)
MBS1138334-01 0.02 mg (E-Coli)

Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)
MBS1138334-02 0.1 mg (E-Coli)

Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)
MBS1138334-03 0.02 mg (Yeast)

Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)
MBS1138334-04 0.1 mg (Yeast)

Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details