Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein phosphatase 1 regulatory subunit 1B (PPP1R1B)

This Recombinant Human Protein phosphatase 1 regulatory subunit 1B (PPP1R1B) spans the amino acid sequence from region 1-168aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein)

UniProt

Q9UD71

Expression Region

1-168aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Embedding Cassettes, Strip Holes, PINK
CG159-1X1000NO 1 unit

Embedding Cassettes, Strip Holes, PINK

Sign In for Pricing
View Details
2- (butan-2-yl) -1H-1,3-benzodiazole
sc-340128A 1 g

2- (butan-2-yl) -1H-1,3-benzodiazole

Sign In for Pricing
View Details
Human EpCAM Recombinant Protein C-6 His Tag Lyophilized 50UG
IHUEPCAMRC6HISLY50UG 50 µg

Human EpCAM Recombinant Protein C-6 His Tag Lyophilized 50UG

Sign In for Pricing
View Details
TMTC2 Recombinant Protein Antigen
NBP1-85027PEP 0.1 mL

TMTC2 Recombinant Protein Antigen

Sign In for Pricing
View Details
GENLISA™ Mouse Sclerostin Domain Containing Protein 1 (SOSTDC1) ELISA
KLM1127 1x 96 Well

GENLISA™ Mouse Sclerostin Domain Containing Protein 1 (SOSTDC1) ELISA

Sign In for Pricing
View Details
Ah Receptor (A-3)
sc-133088 200 µg/mL

Ah Receptor (A-3)

Sign In for Pricing
View Details