Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (VIII) chain (COL8A1), partial

This Recombinant Human Collagen alpha-1 (VIII) chain (COL8A1), partial spans the amino acid sequence from region 572-744aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(VIII) (Endothelial collagen)

UniProt

P27658

Expression Region

572-744aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research; Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ARMC6 Antibody
A16779 100 µL

Anti-ARMC6 Antibody

Sign In for Pricing
View Details
1,3-Dihydrobenzo[c]furan
T7139-01 200 mg

1,3-Dihydrobenzo[c]furan

Sign In for Pricing
View Details
1,3-Dihydrobenzo[c]furan
T7139-02 1 g

1,3-Dihydrobenzo[c]furan

Sign In for Pricing
View Details
Human Breast Cancer Signaling Primer Library
11150097-1 1 Set

Human Breast Cancer Signaling Primer Library

Sign In for Pricing
View Details
Recombinant Mouse Tubulin beta-1 chain (Tubb1)
MBS1245519-01 0.02 mg (E-Coli)

Recombinant Mouse Tubulin beta-1 chain (Tubb1)

Sign In for Pricing
View Details
Recombinant Mouse Tubulin beta-1 chain (Tubb1)
MBS1245519-02 0.02 mg (Yeast)

Recombinant Mouse Tubulin beta-1 chain (Tubb1)

Sign In for Pricing
View Details