Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dipeptidase 1 (DPEP1)

This Recombinant Human Dipeptidase 1 (DPEP1) spans the amino acid sequence from region 17-385aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Beta-lactamase) (Dehydropeptidase-I) (Microsomal dipeptidase) (Renal dipeptidase) (hRDP)

UniProt

P16444

Expression Region

17-385aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Emcn / Endomucin Recombinant Protein
R9680m 1 Each

Mouse Emcn / Endomucin Recombinant Protein

Sign In for Pricing
View Details
F11 (Coagulation Factor XI, FXI, Plasma Thromboplastin Antecedent, PTA, MGC141891) (PE)
MBS6377843-01 0.1 mL

F11 (Coagulation Factor XI, FXI, Plasma Thromboplastin Antecedent, PTA, MGC141891) (PE)

Sign In for Pricing
View Details
F11 (Coagulation Factor XI, FXI, Plasma Thromboplastin Antecedent, PTA, MGC141891) (PE)
MBS6377843-02 5x 0.1 mL

F11 (Coagulation Factor XI, FXI, Plasma Thromboplastin Antecedent, PTA, MGC141891) (PE)

Sign In for Pricing
View Details
Biotinylated Anti-GCGR (volagidemab biosimilar) mAb
12-9159B-100 100 µg

Biotinylated Anti-GCGR (volagidemab biosimilar) mAb

Sign In for Pricing
View Details
TTFA, Mitochondrial Complex II inhibitor
TBI4565-100MG 100 mg

TTFA, Mitochondrial Complex II inhibitor

Sign In for Pricing
View Details
Rabbit Polyclonal Nestin Antibody [mFluor Violet 450 SE]
NB300-265MFV450 0.1 mL

Rabbit Polyclonal Nestin Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details