Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Fibroblast growth factor 2 (FGF2)

This Recombinant Chicken Fibroblast growth factor 2 (FGF2) spans the amino acid sequence from region 13-158aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2)

UniProt

P48800

Expression Region

13-158aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Gallus gallus (Chicken)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp1b1 Rabbit Polyclonal Antibody (HRP)
orb2110379 100 µL

Cyp1b1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
IFKine Green Donkey Goat IgG Antibody
orb3145610-01 100 µL

IFKine Green Donkey Goat IgG Antibody

Sign In for Pricing
View Details
IFKine Green Donkey Goat IgG Antibody
orb3145610-02 500 µL

IFKine Green Donkey Goat IgG Antibody

Sign In for Pricing
View Details
LATS1 Protein (N-His, Human)
P505557 100 µg

LATS1 Protein (N-His, Human)

Sign In for Pricing
View Details
N-[2-(p-Bromocinnamylamino)ethyl]-5-isoquinoline Sulfonamide, Dihydrochloride (H-89)
MBS655452-01 10 mg

N-[2-(p-Bromocinnamylamino)ethyl]-5-isoquinoline Sulfonamide, Dihydrochloride (H-89)

Sign In for Pricing
View Details
N-[2-(p-Bromocinnamylamino)ethyl]-5-isoquinoline Sulfonamide, Dihydrochloride (H-89)
MBS655452-02 5x 10 mg

N-[2-(p-Bromocinnamylamino)ethyl]-5-isoquinoline Sulfonamide, Dihydrochloride (H-89)

Sign In for Pricing
View Details