Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glucose-6-phosphatase catalytic subunit 1 (G6PC1), partial

This Recombinant Human Glucose-6-phosphatase (G6PC), partial spans the amino acid sequence from region 82-117aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Glucose-6-phosphatase) (G-6-Pase) (G6Pase) (Glucose-6-phosphatase alpha) (G6Pase-alpha)

UniProt

P35575

Expression Region

82-117aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

5.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIDE A (CIDEA) (NM_198289) Human Over-expression Lysate
LY405009 100 µg

CIDE A (CIDEA) (NM_198289) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC2A7 siRNA (Rat)
orb1827037-01 15 nmol

SLC2A7 siRNA (Rat)

Sign In for Pricing
View Details
SLC2A7 siRNA (Rat)
orb1827037-02 30 nmol

SLC2A7 siRNA (Rat)

Sign In for Pricing
View Details
IRGQ Knockout NCI-H1299 Polyclonal Cells
ARG30847 1 Million

IRGQ Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
HOXB13 Rabbit Polyclonal Antibody (APC)
orb994343 100 µL

HOXB13 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
NGLY1 Antibody Blocking peptide
orb1447668 500 µg

NGLY1 Antibody Blocking peptide

Sign In for Pricing
View Details