Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Otoraplin (Otor)

This Recombinant Mouse Otoraplin (Otor) spans the amino acid sequence from region 19-128aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Melanoma inhibitory activity-like protein)

UniProt

Q9JIE3

Expression Region

19-128aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HGVFMDKLSSKKLCADEECVYTISLARAQEDYNAPDCRFIDVKKGQQIYVYSKLVTENGAGEFWAGSVYGDHQDEMGIVGYFPSNLVKEQRVYQEATKEIPTTDIDFFCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Human Serum Albumin (HSA) ELISA
KBH15978 1x 96 Well

GENLISA Human Serum Albumin (HSA) ELISA

Sign In for Pricing
View Details
CYP1B1 Antibody (Center) Blocking Peptide
MBS9227357-01 0.5 mg

CYP1B1 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
CYP1B1 Antibody (Center) Blocking Peptide
MBS9227357-02 5x 0.5 mg

CYP1B1 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
OR2AK2 Antibody
orb1269740 400 μl

OR2AK2 Antibody

Sign In for Pricing
View Details
Histone H1.4 Rabbit mAb
F1337-100uL*2 2x 100 μL

Histone H1.4 Rabbit mAb

Sign In for Pricing
View Details
EPS15, CT (Epidermal Growth Factor Receptor Substrate 15, Protein Eps15, AF-1p protein, AF1P) (FITC) discontinued
E3376-04A-FITC 200 µL

EPS15, CT (Epidermal Growth Factor Receptor Substrate 15, Protein Eps15, AF-1p protein, AF1P) (FITC) discontinued

Sign In for Pricing
View Details