Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhipicephalus sanguineus Evasin-3

This Recombinant Rhipicephalus sanguineus Evasin-3 spans the amino acid sequence from region 21-86aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(EVA3)

UniProt

P0C8E8

Expression Region

21-86aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Rhipicephalus sanguineus (Brown dog tick) (Ixodes sanguineus)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVSTIESRTSGDGADNFDVVSCNKNCTSGQNECPEGCFCGLLGQNKKGHCYKIIGNLSGEPPVVRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-STXBP2 Antibody Picoband® (HRP Conjugate)
PB9820-HRP 100 µg/Vial

Anti-STXBP2 Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O1:K1/APEC CHBG Polyclonal Antibody
MBS7166946 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC CHBG Polyclonal Antibody

Sign In for Pricing
View Details
H mgA1 (13B3) Rabbit Monoclonal Antibody
E28M5637 100 µL

H mgA1 (13B3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Lsm6 (NM_030145) AAV Particle
MR200135A1V 250 µL

Mouse Lsm6 (NM_030145) AAV Particle

Sign In for Pricing
View Details
7-Bromo-9-chloro-2,3,4,5-tetrahydro-1,4-benzoxazepine hydrochloride
BKD17764-01 50 mg

7-Bromo-9-chloro-2,3,4,5-tetrahydro-1,4-benzoxazepine hydrochloride

Sign In for Pricing
View Details
7-Bromo-9-chloro-2,3,4,5-tetrahydro-1,4-benzoxazepine hydrochloride
BKD17764-02 0.5 g

7-Bromo-9-chloro-2,3,4,5-tetrahydro-1,4-benzoxazepine hydrochloride

Sign In for Pricing
View Details