Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant African swine fever virus Uncharacterized protein K145R

This Recombinant African swine fever virus Uncharacterized protein K145R (Mal-059) spans the amino acid sequence from region 1-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(pK145R)

UniProt

P0CA49

Expression Region

1-145aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDHYLKKLEDIYKKLEGHPFLFSPSKTNEKEFITLLNQALASTQLYRSIQQLFLTMYKLDPIGFINYIKTSKQEYLCLLINPKLVTKFLKITSFKIYINFRLKTFYISPNKYNNFYTAPSEEKANHLLKEEKTWAKIVEEGGEES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (Morpholine-4-sulfonyl) -benzoic acid
sc-344626A 5 g

3- (Morpholine-4-sulfonyl) -benzoic acid

Sign In for Pricing
View Details
SSH2 Polyclonal Antibody
orb618689-01 50 μL

SSH2 Polyclonal Antibody

Sign In for Pricing
View Details
SSH2 Polyclonal Antibody
orb618689-02 100 µL

SSH2 Polyclonal Antibody

Sign In for Pricing
View Details
RNF20 Rabbit pAb
E45R23621N-50 50 µL

RNF20 Rabbit pAb

Sign In for Pricing
View Details
P62 Antibody
E38QA1642 100 µL

P62 Antibody

Sign In for Pricing
View Details
Mouse IL-11 R alpha (NP_034679) VersaClone cDNA
RDC1472 10 µg

Mouse IL-11 R alpha (NP_034679) VersaClone cDNA

Sign In for Pricing
View Details