Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Giardia intestinalis Surface antigen CRP170, partial

This Recombinant Giardia intestinalis Surface antigen CRP170, partial spans the amino acid sequence from region 1-328aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P15799

Expression Region

1-328aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Giardia intestinalis (Giardia lamblia)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TNPSDPTGTCVSAVDCQGSAGYYTDDSVSDAKECKKCNAPCTACAGTADKCTKCDANGAAPYLKKTNPSDPTGTCVSAVDCQGSAGYYTDDSVSDAKECKKCNAPCTACAGTADKCTKCDANGAAPYLKKTNPSDPTGTCVSAVDCQGSAGYYTDDSVSDAKECKKCAEGQKPNTAGTQCFSCSDANCERCDQNDVCARCSTGAPPENGKCPAATPGCHSSCDGCTENAMTNQADKCTGCKEGRYLKPESAAGQSGACLTAEECTSDKTHFTREKAGDSKGMCLSCSDATHGITGCKKCALKTLSGEAESTVVCSECTDKRLTPSGNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm16519 3'UTR Luciferase Stable Cell Line
TU107761 1.0 mL

Gm16519 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
[4- (Cyanomethyl) -3-methoxyphenyl]boronic acid
CVD60880 250 mg

[4- (Cyanomethyl) -3-methoxyphenyl]boronic acid

Sign In for Pricing
View Details
3-[2- (4-Methoxypyrrolidin-2-yl) -1H-imidazol-4-yl]pyridine trihydrochloride
YGC02903-01 50 mg

3-[2- (4-Methoxypyrrolidin-2-yl) -1H-imidazol-4-yl]pyridine trihydrochloride

Sign In for Pricing
View Details
3-[2- (4-Methoxypyrrolidin-2-yl) -1H-imidazol-4-yl]pyridine trihydrochloride
YGC02903-02 0.5 g

3-[2- (4-Methoxypyrrolidin-2-yl) -1H-imidazol-4-yl]pyridine trihydrochloride

Sign In for Pricing
View Details
Olfr728 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4193505 3x 1.0 µg

Olfr728 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
TOMM40 Protein Vector (Mouse) (pPM-C-HA)
PV240716 500 ng

TOMM40 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details