Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

This Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) spans the amino acid sequence from region 22-176aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PAL, 19 kDa surface antigen, PPL

UniProt

P26493

Expression Region

22-176aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Legionella pneumophila

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RTL10 activation kit by CRISPRa
GA112544 1 Kit

Human RTL10 activation kit by CRISPRa

Sign In for Pricing
View Details
FAM168B (NM_001009993) Human Over-expression Lysate
LY423171 100 µg

FAM168B (NM_001009993) Human Over-expression Lysate

Sign In for Pricing
View Details
RNF123 Antibody
KC-3921-01 50 μL

RNF123 Antibody

Sign In for Pricing
View Details
RNF123 Antibody
KC-3921-02 100 µL

RNF123 Antibody

Sign In for Pricing
View Details
RNF123 Antibody
KC-3921-03 1 mL

RNF123 Antibody

Sign In for Pricing
View Details
Acetyl-Alpha-boswellic Acid
TRC-A145135-1MG 1 mg

Acetyl-Alpha-boswellic Acid

Sign In for Pricing
View Details