Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proteasome subunit beta type-2 (PSMB2)

This Recombinant Human Proteasome subunit beta type-2 (PSMB2) spans the amino acid sequence from region 1-201aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Macropain subunit C7-IMulticatalytic endopeptidase complex subunit C7-IProteasome component C7-I

UniProt

P49721

Expression Region

1-201aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

26S Proteasome Regulatory Subunit 10B (PSMC6) Antibody
abx004118-01 20 µL

26S Proteasome Regulatory Subunit 10B (PSMC6) Antibody

Sign In for Pricing
View Details
26S Proteasome Regulatory Subunit 10B (PSMC6) Antibody
abx004118-02 100 µL

26S Proteasome Regulatory Subunit 10B (PSMC6) Antibody

Sign In for Pricing
View Details
26S Proteasome Regulatory Subunit 10B (PSMC6) Antibody
abx004118-03 2x 100 µL

26S Proteasome Regulatory Subunit 10B (PSMC6) Antibody

Sign In for Pricing
View Details
GLTP (D-9) : m-IgG1 BP-HRP Bundle
sc-542500 1 Kit

GLTP (D-9) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
NT5C1A Antibody - N-terminal region
OAAB06514-400UL 400 µL

NT5C1A Antibody - N-terminal region

Sign In for Pricing
View Details
WDR52 (CFAP44) CytoSection
TS420092P5 25 Slides

WDR52 (CFAP44) CytoSection

Sign In for Pricing
View Details