Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proteasome subunit beta type-2 (PSMB2)

This Recombinant Human Proteasome subunit beta type-2 (PSMB2) spans the amino acid sequence from region 1-201aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Macropain subunit C7-IMulticatalytic endopeptidase complex subunit C7-IProteasome component C7-I

UniProt

P49721

Expression Region

1-201aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Screw cap black, 20-400
1217706 100 / PCK

Screw cap black, 20-400

Sign In for Pricing
View Details
Anti-c-Kit  (1G1)
YF-MA13920 100 ug

Anti-c-Kit (1G1)

Sign In for Pricing
View Details
Mouse Agmo qPCR Primer Pair
QM70126S 200 Tests

Mouse Agmo qPCR Primer Pair

Sign In for Pricing
View Details
SKP2 Polyclonal Antibody, HRP Conjugated
bs-1096R-HRP-TR 20 µL

SKP2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
1H,2H,3H,4H-Cyclopenta[b]indol-2-one
AGA67063-01 50 mg

1H,2H,3H,4H-Cyclopenta[b]indol-2-one

Sign In for Pricing
View Details
1H,2H,3H,4H-Cyclopenta[b]indol-2-one
AGA67063-02 0.5 g

1H,2H,3H,4H-Cyclopenta[b]indol-2-one

Sign In for Pricing
View Details