Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nucleoside diphosphate kinase A (NME1)

This Recombinant Human Nucleoside diphosphate kinase A (NME1) spans the amino acid sequence from region 2-152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Granzyme A-activated DNase ; GAADMetastasis inhibition factor nm23NM23-H1Tumor metastatic process-associated protein

UniProt

P15531

Expression Region

2-152aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPV18 E7 Protein (1-35) Mouse Monoclonal Antibody [Clone ID: 10A8]
AM26117PU-N 100 µg

HPV18 E7 Protein (1-35) Mouse Monoclonal Antibody [Clone ID: 10A8]

Sign In for Pricing
View Details
AP2B1 (Center) Rabbit Polyclonal Antibody
AP50201PU-N 400 µL

AP2B1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EN2 Antibody
KC-3726-01 50 μL

EN2 Antibody

Sign In for Pricing
View Details
EN2 Antibody
KC-3726-02 100 µL

EN2 Antibody

Sign In for Pricing
View Details
EN2 Antibody
KC-3726-03 1 mL

EN2 Antibody

Sign In for Pricing
View Details
14-3-3 zeta (YWHAZ) Rabbit Polyclonal Antibody
AP20468PU-N 100 µg

14-3-3 zeta (YWHAZ) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details