Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)

This Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32) spans the amino acid sequence from region 1-301aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(SSB protein) (Gp32) (Helix-destabilizing protein)

UniProt

P03695

Expression Region

1-301aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC16A6 Protein Lysate
OCOA12999-20UG 20 µg

SLC16A6 Protein Lysate

Sign In for Pricing
View Details
MFluor™ Green 620 Anti-non-human primates/ human CD170 Antibody *1A5*
117000U1-AAT 500 Tests

MFluor™ Green 620 Anti-non-human primates/ human CD170 Antibody *1A5*

Sign In for Pricing
View Details
Rabbit Anti-Rat Galectin 1 (GAL1) Polyclonal Antibody
VD1N444 1 Each

Rabbit Anti-Rat Galectin 1 (GAL1) Polyclonal Antibody

Sign In for Pricing
View Details
ROX Reference Dye (High)
ROXH-50μL 50 μL

ROX Reference Dye (High)

Sign In for Pricing
View Details
ANO2 CRISPR Activation Plasmid (m)
sc-433990-ACT 20 µg

ANO2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
CTNNBL1 (NM_030877) Human Over-expression Lysate
LY403090 100 µg

CTNNBL1 (NM_030877) Human Over-expression Lysate

Sign In for Pricing
View Details