Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial
This Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial spans the amino acid sequence from region 122-199aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(DRADA) (136 kDa double-stranded RNA-binding protein) (p136) (Interferon-inducible protein 4) (IFI-4) (K88DSRBP)
UniProt
P55265
Expression Region
122-199aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Infectious Disease & Virology; Pharmacology & Drug Discovery
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
35.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP50192PU-N 400 µL
Anoctamin 7 (ANO7) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC743142-100 1x 100 µL
Spectrin beta III (SPTBN2) (SPTBN2/3142R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G1]](https://cdn.genprice.uk/products/937/6868c34e994c49e6dc3f40cd/imageurl/ta504054bm.webp)
TA504054BM 100 µL
Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G1]
Sign In for Pricing
View Details 
BNUM1662-50 1x 50 µL
CD31 / PECAM-1 (Endothelial Cell Marker), 1mg/mL
Sign In for Pricing
View Details