Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Agrin (AGRN), partial

This Recombinant Human Agrin (AGRN), partial spans the amino acid sequence from region 1868-2065aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(C90) (C22)

UniProt

O00468

Expression Region

1868-2065aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VDTLAFDGRTFVEYLNAVTESELANEIPVPETLDSGALHSEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELRPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-4323 miRNA Inhibitor
MIH02274 2x 5.0 nmol

hsa-miR-4323 miRNA Inhibitor

Sign In for Pricing
View Details
Egln2 Polyclonal Antibody
CAC08387-01 50 µg

Egln2 Polyclonal Antibody

Sign In for Pricing
View Details
Egln2 Polyclonal Antibody
CAC08387-02 100 µg

Egln2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-LGALS3BP Polyclonal Antibody
HC690014-01 50 µg

Anti-LGALS3BP Polyclonal Antibody

Sign In for Pricing
View Details
Anti-LGALS3BP Polyclonal Antibody
HC690014-02 100 µg

Anti-LGALS3BP Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Plasmodium falciparum Uncharacterized protein PF07_0021 (PF07_0021), partial
MBS1469295 Inquire

Recombinant Plasmodium falciparum Uncharacterized protein PF07_0021 (PF07_0021), partial

Sign In for Pricing
View Details