Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Angiogenin (Ang)

This Recombinant Mouse Angiogenin (Ang) spans the amino acid sequence from region 25-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Angiogenin-1) (Ribonuclease 5) (RNase 5)

UniProt

P21570

Expression Region

25-145aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protein dispatched homolog 2 (DISP2) ELISA Kit
orb1670022-01 48 Tests

Human Protein dispatched homolog 2 (DISP2) ELISA Kit

Sign In for Pricing
View Details
Human Protein dispatched homolog 2 (DISP2) ELISA Kit
orb1670022-02 96 Tests

Human Protein dispatched homolog 2 (DISP2) ELISA Kit

Sign In for Pricing
View Details
Mouse Integrin Associated Protein (IAP) ELISA Kit
DLR-IAP-Mu-01 48 Tests

Mouse Integrin Associated Protein (IAP) ELISA Kit

Sign In for Pricing
View Details
Mouse Integrin Associated Protein (IAP) ELISA Kit
DLR-IAP-Mu-02 96 Tests

Mouse Integrin Associated Protein (IAP) ELISA Kit

Sign In for Pricing
View Details
Anti-PKC epsilon Monoclonal Antibody
M01151 100 µL/Vial

Anti-PKC epsilon Monoclonal Antibody

Sign In for Pricing
View Details
Interleukin 7 (Interleukin-7, IL7, IL-7) (MaxLight 405) discontinued
128550-ML405 100 µL

Interleukin 7 (Interleukin-7, IL7, IL-7) (MaxLight 405) discontinued

Sign In for Pricing
View Details