Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Apolipoprotein E (APOE)

This Recombinant Macaca fascicularis Apolipoprotein E (APOE) spans the amino acid sequence from region 19-317aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Apo-E)

UniProt

P10517

Expression Region

19-317aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KVEQPVEPETEPELRQQAEGQSGQPWELALGRFWDYLRWVQTLSEQVQEELLSPQVTQELTTLMDETMKELKAYKSELEEQLSPVAEETRARLSKELQAAQARLGADMEDVRSRLVQYRSEVQAMLGQSTEELRARLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGVSAIRERLGPLVEQGRVRAATVGSLASQPLQERAQALGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQISLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGASTAPVPIDNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZNF541 sgRNA gene knockout kit - Lentiviral human ZNF541 sgRNA gene knockout kit (100)
GTR15361999 1 Vial

Lentiviral human ZNF541 sgRNA gene knockout kit - Lentiviral human ZNF541 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
ATXN1 Knockout AGS Polyclonal Cells
ARG26705 1 Million

ATXN1 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
TM241 rabbit pAb
RA35374-01 50 µL

TM241 rabbit pAb

Sign In for Pricing
View Details
TM241 rabbit pAb
RA35374-02 100 µL

TM241 rabbit pAb

Sign In for Pricing
View Details
MYL6 Antibody
MBS8588794-01 0.1 mg

MYL6 Antibody

Sign In for Pricing
View Details
MYL6 Antibody
MBS8588794-02 0.1 mL (AF405L)

MYL6 Antibody

Sign In for Pricing
View Details