Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OX-2 membrane glycoprotein (CD200), partial

This Recombinant Human OX-2 membrane glycoprotein (CD200), partial spans the amino acid sequence from region 31-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CD antigen CD200)

UniProt

P41217

Expression Region

31-232aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B2 (X29.2), 1mg/mL
BNUM3059-50 1x 50 µL

Cyclin B2 (X29.2), 1mg/mL

Sign In for Pricing
View Details
RNF215 Human Gene Knockout Kit (CRISPR)
KN423192 1 Kit

RNF215 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LRRC23 Rabbit Polyclonal Antibody
TA367708 100 µL

LRRC23 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARTS1 (ERAP1) Human qPCR Primer Pair (NM_016442)
HP229040 200 Reactions

ARTS1 (ERAP1) Human qPCR Primer Pair (NM_016442)

Sign In for Pricing
View Details
MIF4GD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H9]
TA504558BM 100 µL

MIF4GD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H9]

Sign In for Pricing
View Details
RGS1 Antibody
8C18308-AAT 50 µg

RGS1 Antibody

Sign In for Pricing
View Details