Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OX-2 membrane glycoprotein (CD200), partial

This Recombinant Human OX-2 membrane glycoprotein (CD200), partial spans the amino acid sequence from region 31-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CD antigen CD200)

UniProt

P41217

Expression Region

31-232aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL7AP69 3'UTR Lenti-reporter-Luc Vector
41846081 1.0 µg

RPL7AP69 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Human CD47/MER6 Protein, N-His
AP92115 50 µg

Recombinant Human CD47/MER6 Protein, N-His

Sign In for Pricing
View Details
As3mt sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7048905 3x 1.0 µg

As3mt sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Anti-ECRG4 Antibody
MBS8305543-01 0.03 mL

Anti-ECRG4 Antibody

Sign In for Pricing
View Details
Anti-ECRG4 Antibody
MBS8305543-02 0.05 mL

Anti-ECRG4 Antibody

Sign In for Pricing
View Details
Anti-ECRG4 Antibody
MBS8305543-03 0.1 mL

Anti-ECRG4 Antibody

Sign In for Pricing
View Details