Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acetylcholine receptor subunit epsilon (CHRNE), partial

This Recombinant Human Acetylcholine receptor subunit epsilon (CHRNE), partial spans the amino acid sequence from region 21-239aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q04844

Expression Region

21-239aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACAP receptor Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-23149R-BF750 100 µL

PACAP receptor Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Anti-NUD12 antibody
STJ191140 200 µl

Anti-NUD12 antibody

Sign In for Pricing
View Details
Rhox3h HDR Plasmid (m)
sc-436689-HDR 20 µg

Rhox3h HDR Plasmid (m)

Sign In for Pricing
View Details
SPATC1 Rabbit Polyclonal Antibody
E28PN7064 100 µL

SPATC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ABCE1 Rabbit Monoclonal Antibody
AMRe84261-01 1 Each

ABCE1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ABCE1 Rabbit Monoclonal Antibody
AMRe84261-02 50 µL

ABCE1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details