Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acetylcholine receptor subunit gamma (CHRNG), partial

This Recombinant Human Acetylcholine receptor subunit gamma (CHRNG), partial spans the amino acid sequence from region 23-240aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P07510

Expression Region

23-240aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LOC100129484 activation kit by CRISPRa
GA119098 1 Kit

Human LOC100129484 activation kit by CRISPRa

Sign In for Pricing
View Details
UGT2B10 (NM_001144767) Human Over-expression Lysate
LY428511 100 µg

UGT2B10 (NM_001144767) Human Over-expression Lysate

Sign In for Pricing
View Details
3-O-Acetyl-beta-boswellic Acid
TRC-A177770-1MG 1 mg

3-O-Acetyl-beta-boswellic Acid

Sign In for Pricing
View Details
CD10 Mouse Monoclonal Antibody [A1G3]
EM1901-24 100 µL

CD10 Mouse Monoclonal Antibody [A1G3]

Sign In for Pricing
View Details
ZNF709 Human Gene Knockout Kit (CRISPR)
KN415319 1 Kit

ZNF709 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZBTB40 Rabbit Polyclonal Antibody
TA371992 100 µL

ZBTB40 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details