Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ceroid-lipofuscinosis neuronal protein 5 (CLN5)

This Recombinant Human Ceroid-lipofuscinosis neuronal protein 5 (CLN5) spans the amino acid sequence from region 47-358aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Protein CLN5)

UniProt

O75503

Expression Region

47-358aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon: left
CS713814 5x 5 µm

Tissue FFPE Sections, Colon: left

Sign In for Pricing
View Details
Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), Biotin conjugate, 0.1mg/mL
BNCB3548-100 1x 100 µL

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
"5-Androsten-3,17-dione (>90%)"
TRC-A637563-50MG 50 mg

"5-Androsten-3,17-dione (>90%)"

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human B Cells,  15nm
GM-01-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human B Cells, 15nm

Sign In for Pricing
View Details
Anti-Myc tag (rabbit antibody, polyclonal)
AS21 4529 50 µg

Anti-Myc tag (rabbit antibody, polyclonal)

Sign In for Pricing
View Details
9-cis-Retinoic Acid
TRC-R245000-5MG 5 mg

9-cis-Retinoic Acid

Sign In for Pricing
View Details