Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome c oxidase subunit 5A, mitochondrial (Cox5a)

This Recombinant Mouse Cytochrome c oxidase subunit 5A, mitochondrial (Cox5a) spans the amino acid sequence from region 38-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cytochrome c oxidase polypeptide Va)

UniProt

P12787

Expression Region

38-146aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHA9 (NM_014005) Human Tagged Lenti ORF Clone
RC220977L3 10 µg

PCDHA9 (NM_014005) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FITC-labeled BCMA/TNFRSF17, Human (HEK293, Fc)
HY-P701295 25 µg

FITC-labeled BCMA/TNFRSF17, Human (HEK293, Fc)

Sign In for Pricing
View Details
Rabbit Polyclonal Seasonal H1N1 Hemagglutinin Antibody [Alexa Fluor 750]
NBP2-41106AF750 0.1 mL

Rabbit Polyclonal Seasonal H1N1 Hemagglutinin Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
AAAS ORF Vector (Human) (pORF)
10980011 1.0 µg DNA

AAAS ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
GALNTL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0836607 1.0 µg DNA

GALNTL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
MAT1A Antibody - N-terminal region
OAAB08986-400UL 400 µL

MAT1A Antibody - N-terminal region

Sign In for Pricing
View Details