Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Dipeptidyl peptidase 1 (Ctsc), partial

This Recombinant Mouse Dipeptidyl peptidase 1 (Ctsc), partial spans the amino acid sequence from region 25-134aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cathepsin C) (Cathepsin J) (Dipeptidyl peptidase I) (DPP-I) (DPPI) (Dipeptidyl transferase) (Dipeptidyl peptidase I exclusion domain chain) (Dipeptidyl peptidase I heavy chain) (Dipeptidyl peptidase I light chain)

UniProt

P97821

Expression Region

25-134aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKYEVRGHTAISYCHETMTGWVHDVLGRNW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Alkyl hydroperoxide reductase ELISA Kit
MBS748619-01 48 Well

Bovine Alkyl hydroperoxide reductase ELISA Kit

Sign In for Pricing
View Details
Bovine Alkyl hydroperoxide reductase ELISA Kit
MBS748619-02 96 Well

Bovine Alkyl hydroperoxide reductase ELISA Kit

Sign In for Pricing
View Details
Bovine Alkyl hydroperoxide reductase ELISA Kit
MBS748619-03 5x 96 Well

Bovine Alkyl hydroperoxide reductase ELISA Kit

Sign In for Pricing
View Details
Bovine Alkyl hydroperoxide reductase ELISA Kit
MBS748619-04 10x 96 Well

Bovine Alkyl hydroperoxide reductase ELISA Kit

Sign In for Pricing
View Details
Sheep Cross Linked N-Telopeptide of Type I Collagen (NTXI) ELISA Kit
MBS9349853-01 48 Well

Sheep Cross Linked N-Telopeptide of Type I Collagen (NTXI) ELISA Kit

Sign In for Pricing
View Details
Sheep Cross Linked N-Telopeptide of Type I Collagen (NTXI) ELISA Kit
MBS9349853-02 96 Well

Sheep Cross Linked N-Telopeptide of Type I Collagen (NTXI) ELISA Kit

Sign In for Pricing
View Details