Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fibroblast growth factor 5 (Fgf5)

This Recombinant Mouse Fibroblast growth factor 5 (Fgf5) spans the amino acid sequence from region 21-264aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FGF-5) (Heparin-binding growth factor 5) (HBGF-5)

UniProt

P15656

Expression Region

21-264aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFSSSSASSPVAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPVKPKVPLSQPRRSPSPVKYRLKFRFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FES Antibody (R1L03)
RHC25101 100 μg

Anti-FES Antibody (R1L03)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) PYRF Polyclonal Antibody
MBS7189341 Inquire

Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) PYRF Polyclonal Antibody

Sign In for Pricing
View Details
Phosphoglycerate Mutase 1 (PGAM1) Antibody
abx404190-01 100 µL

Phosphoglycerate Mutase 1 (PGAM1) Antibody

Sign In for Pricing
View Details
Phosphoglycerate Mutase 1 (PGAM1) Antibody
abx404190-02 200 µL

Phosphoglycerate Mutase 1 (PGAM1) Antibody

Sign In for Pricing
View Details
Phosphoglycerate Mutase 1 (PGAM1) Antibody
abx404190-03 1 mL

Phosphoglycerate Mutase 1 (PGAM1) Antibody

Sign In for Pricing
View Details
Anti-Cytochrome P450 2E1/CYP2E1 Antibody Picoband® Fluoro550 Conjugated
A00672-Fluoro550 100 µg/Vial

Anti-Cytochrome P450 2E1/CYP2E1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details