Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bone morphogenetic protein 3B (GDF10)

This Recombinant Human Bone morphogenetic protein 3B (GDF10) spans the amino acid sequence from region 369-478aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GDF-10) (Bone morphogenetic protein 3B) (BMP-3B) (Bone-inducing protein) (BIP)

UniProt

P55107

Expression Region

369-478aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNB1 Knockout HAP1 Polyclonal Cells
ARG22708 1 Million

IFNB1 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
3-Bromo-4-cyclopropylbenzoic acid
OR70320-01 250 mg

3-Bromo-4-cyclopropylbenzoic acid

Sign In for Pricing
View Details
3-Bromo-4-cyclopropylbenzoic acid
OR70320-02 1 g

3-Bromo-4-cyclopropylbenzoic acid

Sign In for Pricing
View Details
3-Bromo-4-cyclopropylbenzoic acid
OR70320-03 5 g

3-Bromo-4-cyclopropylbenzoic acid

Sign In for Pricing
View Details
Acetyl-HIST1H1B (K48) Antibody
A77721-50UL 50 μL

Acetyl-HIST1H1B (K48) Antibody

Sign In for Pricing
View Details
AIBP Antibody
8C14522-AAT 50 µg

AIBP Antibody

Sign In for Pricing
View Details