Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-5 protein (GJA5), partial

This Recombinant Human Gap junction alpha-5 protein (GJA5), partial spans the amino acid sequence from region 227-358aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Connexin-40) (Cx40)

UniProt

P36382

Expression Region

227-358aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPATCH2 Protein Vector (Mouse) (pPM-C-HA)
PV185664 500 ng

GPATCH2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
WD Repeat Domain Phosphoinositide-Interacting Protein 4 / WIPI-4 (WDR45) Antibody
abx448520 100 µg

WD Repeat Domain Phosphoinositide-Interacting Protein 4 / WIPI-4 (WDR45) Antibody

Sign In for Pricing
View Details
Recombinant Human V-set and immunoglobulin domain-containing protein 8 (VSIG8), partial
orb3006947-01 20 µg

Recombinant Human V-set and immunoglobulin domain-containing protein 8 (VSIG8), partial

Sign In for Pricing
View Details
Recombinant Human V-set and immunoglobulin domain-containing protein 8 (VSIG8), partial
orb3006947-02 100 µg

Recombinant Human V-set and immunoglobulin domain-containing protein 8 (VSIG8), partial

Sign In for Pricing
View Details
Recombinant Human V-set and immunoglobulin domain-containing protein 8 (VSIG8), partial
orb3006947-03 1 mg

Recombinant Human V-set and immunoglobulin domain-containing protein 8 (VSIG8), partial

Sign In for Pricing
View Details
LRIG1 Rabbit Polyclonal Antibody (HRP)
orb2610923 100 µg

LRIG1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details