Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 3-hydroxyisobutyrate dehydrogenase, mitochondrial (HIBADH)

This Recombinant Human 3-hydroxyisobutyrate dehydrogenase, mitochondrial (HIBADH) spans the amino acid sequence from region 37-336aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(HIBADH)

UniProt

P31937

Expression Region

37-336aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetanilide for Synthesis
101090 25 25 Kg

Acetanilide for Synthesis

Sign In for Pricing
View Details
Canine Lipase, Monoacylglycerol ELISA Kit
MBS064914-01 48 Well

Canine Lipase, Monoacylglycerol ELISA Kit

Sign In for Pricing
View Details
Canine Lipase, Monoacylglycerol ELISA Kit
MBS064914-02 96 Well

Canine Lipase, Monoacylglycerol ELISA Kit

Sign In for Pricing
View Details
Canine Lipase, Monoacylglycerol ELISA Kit
MBS064914-03 5x 96 Well

Canine Lipase, Monoacylglycerol ELISA Kit

Sign In for Pricing
View Details
Canine Lipase, Monoacylglycerol ELISA Kit
MBS064914-04 10x 96 Well

Canine Lipase, Monoacylglycerol ELISA Kit

Sign In for Pricing
View Details
Mouse H2ab2 activation kit by CRISPRa
GA218015 1 Kit

Mouse H2ab2 activation kit by CRISPRa

Sign In for Pricing
View Details