Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein kinase LATS1 (LATS1), partial

This Recombinant Human Serine/threonine-protein kinase LATS1 (LATS1), partial spans the amino acid sequence from region 705-1090aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Large tumor suppressor homolog 1) (WARTS protein kinase) (h-warts)

UniProt

O95835

Expression Region

705-1090aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAXIP1 Blocking Peptide (N-term)
MBS9229456-01 0.5 mg

PAXIP1 Blocking Peptide (N-term)

Sign In for Pricing
View Details
PAXIP1 Blocking Peptide (N-term)
MBS9229456-02 5x 0.5 mg

PAXIP1 Blocking Peptide (N-term)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human ABCG4 (ATP binding cassette subfamily G member 4) Expressed in vitro E.coli expression system, Full Length
MPX2843K Each

Magic™ Membrane Protein Human ABCG4 (ATP binding cassette subfamily G member 4) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Topo II alpha (phospho Thr1343) Polyclonal Antibody
MBS8520220-01 0.1 mg

Topo II alpha (phospho Thr1343) Polyclonal Antibody

Sign In for Pricing
View Details
Topo II alpha (phospho Thr1343) Polyclonal Antibody
MBS8520220-02 0.1 mL (AF635)

Topo II alpha (phospho Thr1343) Polyclonal Antibody

Sign In for Pricing
View Details
Topo II alpha (phospho Thr1343) Polyclonal Antibody
MBS8520220-03 0.1 mL (AF610)

Topo II alpha (phospho Thr1343) Polyclonal Antibody

Sign In for Pricing
View Details